PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000274300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 351aa    MW: 39635.5 Da    PI: 6.5077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000274300genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-184087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+ l ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
    MDP0000274300 40 RGPWTVEEDLALMNYIANHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 87
                     89********************************************97 PP

2Myb_DNA-binding49.97.3e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000274300  93 RGNISLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 136
                      78899*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.763591IPR017930Myb domain
SuperFamilySSF466891.05E-3037134IPR009057Homeodomain-like
SMARTSM007171.8E-143989IPR001005SANT/Myb domain
PfamPF002493.3E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-224194IPR009057Homeodomain-like
CDDcd001671.45E-114287No hitNo description
PROSITE profilePS5129418.26592142IPR017930Myb domain
SMARTSM007172.6E-1492140IPR001005SANT/Myb domain
PfamPF002491.2E-1493136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2295141IPR009057Homeodomain-like
CDDcd001671.56E-7113136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAKGTRGCNS PSSQVSAEIL NETGSHDHEE AEDQMMDLRR GPWTVEEDLA LMNYIANHGE  60
GRWNSLARCA GLKRTGKSCR LRWLNYLRPD VRRGNISLEE QLLILELHSR WGNRWSKIAQ  120
HLPGRTDNEI KNYWRTRVQK HAKQLKCDVN SKQFKDTMRY LWMPRLVERI QAAAATSTAT  180
NATATNSSIA APATTHHFNN NINNNFQSSA QMLLQPSHHH FGVSSHSQLT PSYSTPENSS  240
TAASSDSFGT QVSPVSDLTD YYTPTTAATA ISVNNNPTPD NSYFVQANHQ VGTYDNYSGY  300
FSNQGFGLEH FQNMDEQNNN DQWGTVDSGD ISDNLWNVED MWFLQQQLSN I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24371404106B-MYB
1h8a_C6e-243713424120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285401e-144FR828540.1 Rosa rugosa mRNA for putative MYB transcription factor (myb7 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008390410.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-95MY108_ARATH; Transcription factor MYB108
TrEMBLM5XQV51e-167M5XQV5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s10080.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.14e-92myb domain protein 108